ZBTB7B (Zinc Finger and BTB Domain Containing 7B, DKFZp686G01254, THPOK, ZBTB15, ZFP67, ZNF857B, c-Krox, hcKrox)

Größe

£685.00

SKU:: 253560
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: ZBTB7B (NP_056956.1, 433aa-537aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D4
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes (e.g., COL1A1; MIM 120150) and has a role in development.[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTMouse monoclonal antibody raised against a partial recombinant ZBTB7B.FPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.