253329
USP5 (Ubiquitin Specific Peptidase 5 (isoPeptidase T), ISOT)
Größe
£685.00
- SKU:
- 253329
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- USP5 (NP_003472, 71aa-180aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4G4
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant USP5. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice