USF2 (Upstream Transcription Factor 2, c-fos Interacting, FIP, bHLHb12)

Größe

£685.00

SKU:: 253304
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: USF2 (NP_003358, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6A9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDMLDPGLDPAASATMouse monoclonal antibody raised against a partial recombinant USF2.AASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.