TSC22D1 (TSC22 Domain Family, Member 1, DKFZp686O19206, MGC17597, RP11-269C23.2, TGFB1I4, TSC22)

Größe

£685.00

SKU:: 253043
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: TSC22D1 (AAH16867, 1aa-144aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 200
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: TSC22D1 encodes a transcription factor and belongs to the large family of early response genes.[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.