253042-BIOTIN

TSC22D1 (TSC22 Domain Family, Member 1, DKFZp686O19206, MGC17597, RP11-269C23.2, TGFB1I4, TSC22) (Biotin)

Größe

£914.00

SKU:: 253042-BIOTIN
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: TSC22D1 (AAH00456, 1aa-144aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: TSC22D1 encodes a transcription factor and belongs to the large family of early response genes.[supplied by OMIM. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.