252911
TP53RK (TP53 Regulating Kinase, BUD32, C20orf64, Nori-2, Nori-2p, PRPK, dJ101A2)
Größe
£685.00
- SKU:
- 252911
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- TP53RK (AAH09727, 154aa-253aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 200000000
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant TP53RK. Applications: Suitable for use in Immunofluorescence, Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice