TMBIM4 (Transmembrane BAX Inhibitor Motif Containing 4, CGI-119, GAAP, S1R, ZPRO)

Größe

£685.00

SKU:: 252783
Anwendung:: WB
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: TMBIM4 (AAI56585.1, 1aa-238aa) full-length human protein.
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mouse polyclonal antibody raised against a full-length human TMBIM4 protein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLMouse polyclonal antibody raised against a full-length human TMBIM4 protein.GALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.