252568-FITC
TFDP3 (Transcription Factor Dp Family, Member 3, CT30, E2F-like, HCA661, MGC161639) (FITC)
Größe
£914.00
- SKU:
- 252568-FITC
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- TFDP3 (NP_057605, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3F11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- TFDP3 is a member of the DP family of proteins, which form heterodimers with E2F proteins (see E2F1; MIM 189971) and regulate transcription (Qiao et al., 2007 [PubMed 17062573]).[supplied by OMIM Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice