252568-APC

TFDP3 (Transcription Factor Dp Family, Member 3, CT30, E2F-like, HCA661, MGC161639) (APC)

Größe

£914.00

SKU:: 252568-APC
Reinheit:: Purified
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: TFDP3 (NP_057605, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F11
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: TFDP3 is a member of the DP family of proteins, which form heterodimers with E2F proteins (see E2F1; MIM 189971) and regulate transcription (Qiao et al., 2007 [PubMed 17062573]).[supplied by OMIM Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.