TCF7 (Transcription Factor 7 (T-Cell Specific, HMG-Box), FLJ36364, MGC47735, TCF-1)

Größe

£685.00

SKU:: 252484
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: TCF7 (NP_003193, 287aa-384aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2.0e+9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant TCF7. Applications: Suitable for use in Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKMouse monoclonal antibody raised against a partial recombinant TCF7.PAPFLPMTVL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.