TCF3 (Transcription Factor 3 (E2A Immunoglobulin Enhancer Binding Factors E12/E47), E2A, ITF1, MGC129647, MGC129648, bHLHb21)

Größe

£698.00

SKU:: 252479
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: TCF3 (NP_003191, 545aa-654aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5G2
Format:: Supplied as a liquid.
Weitere Details:: The TCF3 gene, also called E2A, encodes 2 basic helix-loop-helix (bHLH) transcription factors, E12 and E47, through alternative splicing. E12 and E47 are involved in regulation of immunoglobulin gene expression (Bain et al., 1994 [PubMed 8001125]).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.