252422-APC
TBL1XR1 (Transducin (beta)-like 1 X-Linked Receptor 1, C21, DC42, FLJ12894, IRA1, TBLR1) (APC)
Größe
£914.00
- SKU:
- 252422-APC
- Reinheit:
- Purified
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- TBL1XR1 (NP_071347, 81aa-178aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 400
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSLIDAVMPDVVQTRQQAYRDKLAQQQMouse monoclonal antibody raised against a partial recombinant TBL1XR1.Mouse monoclonal antibody raised against a partial recombinant TBL1XR1.Mouse monoclonal antibody raised against a partial recombinant TBL1XR1.AASQQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHESEVFICAWN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice