SYNE1 (spectrin Repeat Containing, Nuclear envelope 1, 8B, CPG2, DKFZp781J13156, FLJ30878, FLJ41140, KIAA0796, KIAA1262, KIAA1756, MYNE1, SCAR8)

Größe

£698.00

SKU:: 252315
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: SYNE1 (NP_892006, 1561aa-1670aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C3
Format:: Supplied as a liquid.
Weitere Details:: This gene encodes a spectrin repeat containing protein expressed in skeletal and smooth muscle, and peripheral blood lymphocytes, that localizes to the nuclear membrane. Mutations in this gene have been associated with autosomal recessive spinocerebellar ataxia 8, also referred to as autosomal recessive cerebellar ataxia type 1 or recessive ataxia of Beauce. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEMouse monoclonal antibody raised against a partial recombinant SYNE1.LQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.