251977-BIOTIN

SOX21 (SRY (Sex Determining Region Y)-Box 21, SOX25) (Biotin)

Größe

£914.00

SKU:: 251977-BIOTIN
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: SOX21 (NP_009015, 91aa-184aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3H4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKMouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.ARVFFPQSMouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.AGSPYSLLDLGSKMAEISS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice