251977-APC
SOX21 (SRY (Sex Determining Region Y)-Box 21, SOX25) (APC)
Größe
£914.00
- SKU:
- 251977-APC
- Reinheit:
- Purified
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- SOX21 (NP_009015, 91aa-184aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3H4
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKMouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.ARVFFPQSMouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.AGSPYSLLDLGSKMAEISS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice