SMARCD2 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of chromatin, Subfamily d, Member 2, BAF60B, CRACD2, PRO2451, Rsc6p)

Größe

£685.00

SKU:: 251851
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: SMARCD2 (NP_003068, 398aa-474aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.