SMAD9 (SMAD Family Member 9, MADH6, MADH9, SMAD8A, SMAD8B)

Größe

£685.00

SKU:: 251839
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: SMAD9 (NP_005896, 146aa-260aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: SMAD family members, such as SMAD9, transduce signals from members of the TGF-beta (see TGFB1; MIM 190180) superfamily, which regulate growth, differentiation, apoptosis, and development (Nishita et al., 1999 [PubMed 10583507]).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.