SMA4 (Glucuronidase, beta Pseudogene, FLJ36702, MGC22265, MGC60382, SMA3, b55C20.2)

Größe

£685.00

SKU:: 251771
Anwendung:: WB
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: SMA4 (-, 1aa-140aa) full-length human protein.
Format:: Supplied as a liquid. No preservative added.
Weitere Details:: Mouse polyclonal antibody raised against a full-length human SMA4 protein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSMouse polyclonal antibody raised against a full-length human SMA4 protein.GRPV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.