SLC9A9 (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 9, FLJ35613, NHE9, Nbla00118)

Größe

£685.00

SKU:: 251764
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: SLC9A9 (NP_775924.1, 71aa-126aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1.0e+10
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant SLC9A9. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: APTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAILEK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.