251571-BIOTIN

SFRS6 (Splicing Factor, Arginine/Serine-Rich 6, B52, FLJ08061, MGC5045, SRP55) (Biotin)

Größe

£914.00

SKU:: 251571-BIOTIN
Reinheit:: Purified
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-74 from human SFRS6 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6A10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.