SERPINC1 (Serpin Peptidase Inhibitor, Clade C (antithrombin), Member 1, AT3, ATIII, MGC22579)

Größe

£698.00

SKU:: 251532
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: SERPINC1 (AAH22309.1, 1aa-259aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B12
Format:: Supplied as a liquid.
Weitere Details:: The protein encoded by this gene is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade. The protein includes two functional domains: the heparin binding-domain at the N-terminus of the mature protein, and the reactive site domain at the C-terminus. The inhibitory activity is enhanced by the presence of heparin. More than 120 mutations have been identified for this gene, many of which are known to cause antithrombin-III deficiency. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAEPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNDLYVSDAFHKAFLEVNEEGSEMouse monoclonal antibody raised against a full-length recombinant SERPINC1.STAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVANPCVK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice