RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB)

Größe

£685.00

SKU:: 251329
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: RUNX1 (NP_001745, 376aa-480aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3.0e+9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.