251298
RPS6KC1 (Ribosomal Protein S6 Kinase, 52kD, Polypeptide 1, RPK118, humS6PKh1)
Größe
£698.00
- SKU:
- 251298
- Reinheit:
- Ascites
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- RPS6KC1 (NP_036556, 957aa-1066aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4C6
- Format:
- Supplied as a liquid.
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant RPS6KC1. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SCDSDAIERMYCAPEVGAITEETEACDWWSLGAVLFELLTGKTLVECHPAGINTHTTLNMPECVSEEARSLIQQLLQFNPLERLGAGVAGVEDIKSHPFFTPVDWAELMR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice