RPGRIP1 (Retinitis Pigmentosa GTPase Regulator Interacting Protein 1, CORD9, DKFZp686P0897, LCA6, RGI1, RGRIP, RPGRIP, RPGRIP1d)

Größe

£685.00

SKU:: 251250
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: RPGRIP1 (NP_065099.2, 1187aa-1286aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5H2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a photoreceptor protein that interacts with retinitis pigmentosa GTPase regulator protein and is a key component of cone and rod photoreceptor cells. Mutations in this gene lead to autosomal recessive congenital blindness. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QGRRRFLFDMLNGQDPDQGHLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPIGRLKVSLQMouse monoclonal antibody raised against a partial recombinant RPGRIP1.VLHAIYKEMTEDLFS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.