RIPK2 (Receptor-Interacting Serine-Threonine Kinase 2, CARD3, CARDIAK, CCK, GIG30, RICK, RIP2)

Größe

£685.00

SKU:: 251142
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa431-540 from human RIPK2 with GST tag. MW of the GST tag alone is 26kD. GeneBank: AAH04553
Klon:: 3D9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq Applications: Suitable for use in Western Blot, ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry (Paraffin): 1.2ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.