251078-BIOTIN

RGL2 (ral Guanine Nucleotide Dissociation Stimulator-like 2, HKE1.5, KE1.5, RAB2L) (Biotin)

Größe

£914.00

SKU:: 251078-BIOTIN
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: RGL2 (AAH32681, 644aa-743aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant RGL2. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.