PRKRIP1 (PRKR Interacting Protein 1 (IL11 Inducible), C114, FLJ13902, FLJ40957)

Größe

£698.00

SKU:: 250504
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: PRKRIP1 (AAH14298, 1aa-184aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: M2
Format:: Supplied as a liquid.
Weitere Details:: Mouse monoclonal antibody raised against a full-length recombinant PRKRIP1. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.