PRDM1 (PR Domain Containing 1, with ZNF Domain, BLIMP1, MGC118922, MGC118923, MGC118924, MGC118925, PRDI-BF1)

Größe

£685.00

SKU:: 250437
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: PRDM1 (NP_001189, 422aa-493aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2A3
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HPMLNPTSLPSSLPSDGARRLLQPEHPREVLVPAPHSAFSFTGMouse monoclonal antibody raised against a full-length recombinant PRDM1.SMKDKACSPTSGSPTAGTAATAEHV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.