PPP1R2P3 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 2 Pseudogene 3, MGC87149)

Größe

£698.00

SKU:: 250397
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: PPP1R2P3 (AAH66922, 1aa-205aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G11
Format:: Supplied as a liquid.
Weitere Details:: Mouse monoclonal antibody raised against a full-length recombinant PPP1R2P3. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAASTASHRPIKGILKNKTSTTSSMVASAEQPRRSVDEELSKKSQKWDEINILATYHPADKGYGLMKIDEPSPPYHSMMGDDEDACRDTETTEAMAPGILAKKLMouse monoclonal antibody raised against a full-length recombinant PPP1R2P3.EGLEPKYRIQEQESSGEEDSDLSPEEREKKRQFEMRRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.