250349-HRP

PPFIBP2 (PTPRF Interacting Protein, Binding Protein 2 (liprin beta 2), Cclp1, DKFZp781K06126, MGC42541) (HRP)

Größe

£914.00

SKU:: 250349-HRP
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: PPFIBP2 (NP_003612, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Weitere Details:: PPFIBP2, or liprin-beta-2, belongs to the liprin-beta family. See liprin-beta-1 (MIM 603141) for background on liprins.[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASDASHALEAALEQMDGIIAGTKTGADLSDGTCEPGLASPASYMNPFPVLHLIEDLRLALEMLELPQERAALLSQIPGPTAAYIKEWFEESLSQVNHHS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.