PNCK (Pregnancy up-Regulated non-Ubiquitously Expressed CaM Kinase, BSTK3, CaMK1b, FLJ50403, FLJ50549, FLJ56451, FLJ59811, MGC45419)

Größe

£685.00

SKU:: 250255
Anwendung:: WB
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: PNCK (AAH33746.1, 1aa-121aa) full-length human protein.
Format:: Supplied as a liquid. No preservative added.
Weitere Details:: PNCK is a member of the calcium/calmodulin-dependent protein kinase family of protein serine/threonine kinases (see CAMK1; MIM 604998) (Gardner et al., 2000 [PubMed 10673339]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLLLKKHTEDISSVYEIRERLGSGPSPLHSLSLLPLLSSHFLPTSHRPVCGRGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.