PIP5K3 (Phosphatidylinositol-3-Phosphate/Phosphatidylinositol 5-Kinase, Type III, CFD, FAB1, KIAA0981, MGC40423, PIKFYVE, PIP5K)

Größe

£685.00

SKU:: 250132
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: PIP5K3 (NP_689884, 342aa-451aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D11
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.