250132-PE

PIP5K3 (Phosphatidylinositol-3-Phosphate/Phosphatidylinositol 5-Kinase, Type III, CFD, FAB1, KIAA0981, MGC40423, PIKFYVE, PIP5K) (PE)

Größe

£914.00

SKU:: 250132-PE
Reinheit:: Purified
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: PIP5K3 (NP_689884, 342aa-451aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.