249977-FITC

PELP1 (Proline, Glutamate and Leucine Rich Protein 1, HMX3, MNAR, P160) (FITC)

Größe

£914.00

SKU:: 249977-FITC
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: PELP1 (AAW80659.1, 337aa-410aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: PELP1 is a coactivator of estrogen receptor (see ESR1; MIM 133430)-mediated transcription and a corepressor of other nuclear hormone receptors and sequence-specific transcription factors (Choi et al., 2004 [PubMed 15456770]).[supplied by OMIM Applications: Suitable for use in Immunofluorescence, FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.