PEA15 (Phosphoprotein enriched in astrocytes 15, HMAT1, HUMMAT1H, MAT1, MAT1H, PEA-15, PED)

Größe

£685.00

SKU:: 249968
Anwendung:: WB
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: PEA15 (AAH10469.1, 1aa-74aa) full-length human protein.
Format:: Supplied as a liquid. No preservative added.
Weitere Details:: PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MYIKTALPCLPFFVVSSINLLSRPERGWEGNATVKGVAESSCYIVQTKKKAFSKNIKFTCSLRDYLDKVQVRSF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.