PASK (PAS Domain Containing Serine/Threonine Kinase, DKFZp434O051, DKFZp686P2031, KIAA0135, PASKIN, STK37)

Größe

£698.00

SKU:: 249752
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: PASK (AAH63585, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6B7
Format:: Supplied as a liquid.
Weitere Details:: PAS domains regulate the function of many intracellular signaling pathways in response to both extrinsic and intrinsic stimuli. PASK is an evolutionarily conserved protein present in yeast, flies, and mammals.[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQSRTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.