OPA3 (Pptic Atrophy 3 (Autosomal Recessive, with chorea and spastic paraplegia), FLJ22187, FLJ25932, MGA3, MGC75494)

Größe

£698.00

SKU:: 249606
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: OPA3 (NP_079412.1, 103aa-179aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B8
Format:: Supplied as a liquid.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant OPA3. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQTQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.