249497
NRK (Nik Related Kinase, DKFZp686A17109, FLJ16788, MGC131849, NESK)
Größe
£685.00
- SKU:
- 249497
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- NRK (NP_940867, 1483aa-1582aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4C7
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- NRK is a member of the GCK (MIM 138079) subfamily of protein kinases that are involved in activating the JNK pathway (Kanai-Azuma et al., 1999 [PubMed 10559491]).[supplied by OMIM Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VEANEQLFKKILEMWKDIPSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice