NOL3 (Nucleolar Protein 3 (Apoptosis Repressor with CARD Domain), ARC, CARD2, MYC, MYP, NOP, NOP30)

Größe

£698.00

SKU:: 249393
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: NOL3 (NP_003937.1, 1aa-208aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6F5
Format:: Supplied as a liquid.
Weitere Details:: Mouse monoclonal antibody raised against a full-length recombinant NOL3. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.