NME7 (Non-Metastatic Cells 7, Protein Expressed in (Nucleoside-Diphosphate Kinase), FLJ37194, nm23-H7)

Größe

£698.00

SKU:: 249370
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: NME7 (NP_004547, 277aa-374aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A11
Format:: Supplied as a liquid.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant NME7. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.