NKX3-1 (NK3 Homeobox 1, BAPX2, NKX3, NKX3.1, NKX3A)

Größe

£685.00

SKU:: 249338
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: NKX3-1 (NP_006158, 100aa-209aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.