NDOR1 (NADPH Dependent diflavin oxidoreductase 1, MGC138148, NR1, bA350O14.9)

Größe

£685.00

SKU:: 249185
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: NDOR1 (NP_055249, 498aa-595aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5A7
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein is an enzyme that catalyzes the transfers electrons from NADPH through FAD and FMN cofactors to potential redox partners. Alternative splicing results in multiple transcript variants. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDMouse monoclonal antibody raised against a partial recombinant NDOR1.YLARLQQTRRFQTET Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.