248799-APC
MLLT6 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila); Translocated to, 6, AF17, FLJ23480) (APC)
Größe
£914.00
- SKU:
- 248799-APC
- Reinheit:
- Purified
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- MLLT6 (AAH07237, 1aa-462aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B2
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Mouse monoclonal antibody raised against a full length recombinant MLLT6. Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLNGLLGGLNGMouse monoclonal antibody raised against a full length recombinant MLLT6.PNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPSLGNNTSLMMouse monoclonal antibody raised against a full length recombinant MLLT6.Mouse monoclonal antibody raised against a full length recombinant MLLT6.AAVMouse monoclonal antibody raised against a full length recombinant MLLT6.GGPPVLTAQTNPFLSLSGAEGSGGGPKGGTADKGASANQEKG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice