248689-APC
MESP2 (Mesoderm Posterior 2 Homolog (mouse), SCDO2, bHLHc6) (APC)
Größe
£914.00
- SKU:
- 248689-APC
- Anwendung:
- FLISA
- Reinheit:
- Purified
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- MESP2 (XP_085261, 2aa-125aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1.0e+11
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- This gene encodes a member of the bHLH family of transcription factors and plays a key role in defining the rostrocaudal patterning of somites via interactions with multiple Notch signaling pathways. This gene is expressed in the anterior presomitic mesoderm and is downregulated immediately after the formation of segmented somites. This gene also plays a role in the formation of epithelial somitic mesoderm and cardiac mesoderm. Mutations in the MESP2 gene cause autosomal recessive spondylocostal dystosis 2 (SCD02). [provided by RefSeq Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEMouse monoclonal antibody raised against a full length recombinant MESP2.TTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETL* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice