248542-HRP
MARCKS (myristoylated alanine-Rich Protein Kinase C Substrate, 80K-L, FLJ14368, FLJ90045, MACS, PKCSL, PRKCSL) (HRP)
Größe
£914.00
- SKU:
- 248542-HRP
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- MARCKS (NP_002347, 2aa-65aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2H4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GAQFSKTAAKGEMouse monoclonal antibody raised against a partial recombinant MARCKS.ERPGEAAVASSPSKANGQENGHVKVNGDASPMouse monoclonal antibody raised against a partial recombinant MARCKS.ESGAKEELQANGSAP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice