248315
LRP5 (Low Density Lipoprotein Receptor-Related Protein 5, BMND1, EVR1, EVR4, HBM, LR3, LRP7, OPPG, OPS, OPTA1, VBCH2)
Größe
£698.00
- SKU:
- 248315
- Reinheit:
- Ascites
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- LRP5 (NP_002326.1, 41aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1.0e+9
- Format:
- Supplied as a liquid.
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant LRP5. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RDVRLVDAGGVKLESTIVVSGLEDMouse monoclonal antibody raised against a partial recombinant LRP5.VDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice