LEF1 (Lymphoid Enhancer-Binding Factor 1, DKFZp586H0919, TCF1ALPHA)

Größe

£685.00

SKU:: 248113
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: LEF1 (NP_057353, 33aa-138aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: LEF1 is a nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905) (Waterman et al., 1991 [PubMed 2010090]; van Genderen et al., 1994 [PubMed 7958926]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.