KCNC3 (Potassium Voltage-gated Channel, Shaw-Related Subfamily, Member 3, KSHIIID, KV3.3, SCA13)

Größe

£685.00

SKU:: 247811
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: KCNC3 (NP_004968, 671aa-757aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6F7
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANMouse monoclonal antibody raised against a partial recombinant KCNC3.WISP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.