ID3 (Inhibitor of DNA Binding 3, Dominant Negative Helix-loop-Helix Protein, HEIR-1, bHLHb25)

Größe

£685.00

SKU:: 247374
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: ID3 (NP_002158, 1aa-83aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3.0e+10
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA.[supplied by OMIM Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.