HMHA1 (histocompatibility (minor) HA-1, HA-1, HLA-HA1, KIAA0223)

Größe

£685.00

SKU:: 247151
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: HMHA1 (AAH65223.1, 91aa-190aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H7
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant HMHA1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLHDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.